If you have been reading about PTMA gene and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-10-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
Thymosin beta-4 is a separate 43-residue peptide that binds actin and participates in cell migration; it shares no sequence similarity with thymosin alpha-1 despite the common family name. Other preparative materials, such as thymosin fraction 5 and thymopoietin, contain distinct mixtures or peptides. The shared thymosin label reflects the tissue of origin used in early purification, not a common structural core. Treating these molecules as interchangeable is a frequent source of confusion in laboratory reports and in popular summaries alike.
Thymosin alpha-1 is a synthetic peptide of 28 amino acid residues that corresponds to a naturally occurring fragment first isolated from thymus tissue. Its chain is acetylated at the amino terminus, a modification that shields the peptide from rapid cleavage by aminopeptidases. The molecule carries a net negative charge at physiological pH and dissolves freely in water. Researchers classify it as an immune-modulating agent rather than a classical hormone, because it acts on several cell types of both the innate and the adaptive immune system.
The peptide was identified during work in the 1970s on thymosin fraction 5, a partially purified extract of calf thymus. Investigators separated that mixture and characterized individual components, one of which they named thymosin alpha-1. The same compound later received the international nonproprietary name thymalfasin. Commercial material is produced by solid-phase peptide synthesis rather than by extraction, so synthetic and natural forms share an identical sequence. Naming conventions vary across the literature, and readers should distinguish the alpha-1 peptide from other thymosins that have unrelated sequences and functions.
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
Clinical interest has centered on chronic viral hepatitis, on immune restoration in various conditions, and on use as an adjuvant intended to improve responses to vaccines. Trials have reported mixed results, and regulatory status differs sharply between countries; in some places it is a prescription product, while elsewhere it is sold without an approved therapeutic indication. Because published studies vary widely in design, population, and endpoints, comparisons across them are difficult and no single conclusion covers the whole literature.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | About 3.1 kDa | 28 residues, N-terminally acetylated |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Freely soluble in water | Also soluble in aqueous buffers |
| Storage temperature | 2 to 8 °C | Protect from light and moisture |
| Common synonyms | Thymalfasin; Tα1 | Same peptide sequence |
The peptide is generated in cells by cleavage of prothymosin alpha, a larger acidic protein encoded by the PTMA gene. Prothymosin alpha is expressed in many tissues, not only in the thymus, and its functions include nuclear roles in chromatin-related processes. The 28-residue fragment corresponds to the N-terminal portion of that precursor. How the cleavage occurs and how the fragment's concentration is regulated remain open questions; circulating amounts are small and difficult to measure reliably with routine assays.
Thymosin alpha 1 is a short peptide first isolated from bovine thymus tissue in the early 1970s during fractionation work aimed at identifying factors that influence T cell development. It belongs to a family of acidic thymic peptides, and the original preparations contained several components that were later separated by chromatography. The compound is now produced synthetically rather than extracted from tissue, which removes batch variability tied to animal sourcing. Researchers describe it as an immunomodulatory peptide because laboratory studies show effects on several cell types of the innate and adaptive immune systems.
Immunological studies connect the peptide to multiple parts of the immune response. It has been reported to engage Toll-like receptor signaling, to promote dendritic cell maturation, and to influence the balance of T helper cell subsets. Changes in natural killer cell activity and in cytokine release appear in cell culture and animal models. These observations describe broad immunomodulatory behavior rather than a single defined receptor target, and the primary molecular interaction has not been settled.
Thymosin alpha-1 is a synthetic 28-amino-acid peptide whose sequence was first identified in extracts of bovine thymus tissue during the 1970s. The chain carries an acetyl group on its N-terminal serine. Its acidic residue content is high, which produces strong water solubility and an isoelectric point well below neutrality. Material supplied for laboratory and clinical use is manufactured by solid-phase peptide synthesis rather than purified from animal tissue. Different salt forms, such as the acetate, alter the counter-ion content without changing the peptide backbone.
==== Season 4 ==== Months later, Logan remains estranged from his children. On the eve of the GoJo acquisition, Sandi and Stewy convince the siblings to delay the board vote to increase the price of the sale, forcing Logan to attempt reconciliation with his children. Kendall and Shiv refuse to budge, unsuccessfully demanding an apology from their father for his betrayal and his cruel parenting. Logan is then left no choice but to go to Sweden to renegotiate the deal with Matsson, but he suddenly dies on the flight from a pulmonary embolism, with only Tom and some of his other senior team by his side. Tom phones the children - who are attending Connor's wedding - to give them a chance to say goodbye. The plane is turned around and Logan is pronounced dead on arrival; the siblings make a statement announcing his death to the press, then watch as his body is removed from the plane. During Logan's wake, an undated document is found in his safe naming Kendall his successor upon his death, with several pencil addenda included, including a strike on "Kendall Roy" that could be either underlining or crossing-out the name. Kendall and Roman eventually decide to run the company together as co-CEOs, since the company's succession plan formally dictated leadership be passed down to COO - Roman's role at the time.
Labiaplasty (also known as labioplasty, labia minora reduction, and labial reduction) is a plastic surgery procedure for creating or altering the labia minora (inner labia) and the labia majora (outer labia), the folds of skin of the human vulva. It is a type of vulvoplasty. There are two main categories of women seeking cosmetic genital surgery: those with conditions such as intersex, and those with no underlying condition who experience physical discomfort or wish to alter the appearance of their vulvas because they believe they do not fall within a normal range. The size, colour, and shape of labia vary significantly, and may change as a result of childbirth, aging, and other events. Conditions addressed by labiaplasty include congenital defects and abnormalities such as vaginal atresia (absent vaginal passage), Müllerian agenesis (malformed uterus and fallopian tubes), intersex conditions (male and female sexual characteristics in a person); and tearing and stretching of the labia minora caused by childbirth, accident, and age. In feminizing vaginoplasty for the creation of a neovagina, labiaplasty creates labia where once there were none. A 2008 study reported that 32 percent of women who underwent the procedure did so to correct a functional impairment; 31 percent to correct a functional impairment and for aesthetic reasons; and 37 percent for aesthetic reasons alone. According to a 2011 review, overall patient satisfaction is in the 90–95 percent range.
== Pathology == Superoxides are crucial in killing foreign bacteria in the human body. Consequently, under-activity can lead to an increased susceptibility to organisms such as catalase-positive microbes, and over-activity can lead to oxidative stress and cell damage. Excessive production of ROS in vascular cells causes many forms of cardiovascular disease including hypertension, atherosclerosis, myocardial infarction, and ischemic stroke. Atherosclerosis is caused by the accumulation of macrophages containing cholesterol (foam cells) in artery walls (in the intima). ROS produced by NADPH oxidase activate an enzyme that makes the macrophages adhere to the artery wall (by polymerizing actin fibers). This process is counterbalanced by NADPH oxidase inhibitors, and by antioxidants. An imbalance in favor of ROS produces atherosclerosis. In vitro studies have found that the NADPH oxidase inhibitors apocynin and diphenyleneiodonium, along with the antioxidants N-acetyl-cysteine and resveratrol, depolymerized the actin, broke the adhesions, and allowed foam cells to migrate out of the intima. One study suggests a role for NADPH oxidase in ketamine-induced loss of neuronal parvalbumin and GAD67 expression. Similar loss is observed in schizophrenia, and the results may point at the NADPH oxidase as a possible player in the pathophysiology of the disease.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Sources: en.wikipedia.org
Control of the process of gene transcription affects patterns of gene expression and, thereby, allows a cell to adapt to a changing environment, perform specialized roles within a multicellular organism, and maintain basic metabolic processes necessary for survival. The activity of RNAP is complex and highly regulated. In Escherichia coli bacteria, more than 100 transcription factors have been identified, which modify the activity of RNAP. RNAP can initiate transcription at specific DNA sequences known as promoters. It then produces an RNA chain, which is complementary to the template DNA strand. The process of adding nucleotides to the RNA strand is known as elongation; in eukaryotes, RNAP can build chains as long as 2.4 million nucleotides (the full length of the dystrophin gene). RNAP will preferentially release its RNA transcript at specific DNA sequences encoded at the end of genes, which are known as terminators. Products of RNAP include:
Their global dissemination is driven in part by horizontal gene transfer on plasmids and has been associated with selection pressure from colistin use, particularly in food-producing animals. Mobile colistin resistance genes also occur in settings without local agricultural colistin use. A 2026 genomic study from New Zealand, where colistin has never been licensed for use in food-producing animals, characterized 71 mcr-positive clinical isolates and compared them with 1,543 mcr-carrying plasmids sampled from 60 countries and regions between 1984 and 2024. The analysis resolved 14 major plasmid lineages associated with different mcr variants and found frequent co-carriage of other antimicrobial-resistance genes, indicating that transmissible plasmid backbones and co-selection by other resistance determinants can contribute to the persistence and dissemination of mcr genes even where direct colistin selection pressure is limited. The emergence of the mcr-9 gene is quite remarkable. Use of colistin to treat Acinetobacter baumannii infections has led to the development of resistant bacterial strains. They have also developed resistance to the antimicrobial compounds LL-37 and lysozyme, produced by the human immune system. This cross-resistance is caused by gain-of-function mutations to the pmrB gene, which controls the expression of lipid A phosphoethanolamine transferases (similar to mcr-1) located on the bacterial chromosome. Similar results have been obtained with mcr-1 positive E.
The Fugates, a family that lived in the hills of Kentucky in the US, had the hereditary form. They are known as the "Blue Fugates". Martin Fugate and Elizabeth Smith, who had married and settled near Hazard, Kentucky, around 1800, were both carriers of the recessive methemoglobinemia (met-H) gene, as was a nearby clan with whom the Fugates descendants intermarried. As a result, many descendants of the Fugates were born with met-H.
Day of Defeat was followed by Day of Defeat: Source, a remake of the game that runs on Valve's Source engine. The Source remake included significant changes to Day of Defeat's gameplay, new maps, updated graphics, and improved physics. Released on September 26, 2005 to favorable reviews, the game was praised for its gameplay, audio, and graphics. Post-release, the game was supported by Valve with a number of subsequent updates, including versions of the game for OS X and Linux released in 2010 and 2013 respectively.
Health behavior refers to a person's beliefs and actions regarding their health and well-being. Health behaviors are direct factors in maintaining a healthy lifestyle. Health behaviors are influenced by the social, cultural, and physical environments in which we live. They are shaped by individual choices and external constraints. Positive behaviors help promote health and prevent disease, while the opposite is true for risk behaviors. Health behaviors are early indicators of population health. Because of the time lag that often occurs between certain behaviors and the development of disease, these indicators may foreshadow the future burdens and benefits of health-risk and health-promoting behaviors.
Sources: en.wikipedia.org
Aquileia is a comune (municipality) in the Friuli-Venezia Giulia region of northeastern Italy. It is situated at the head of the Adriatic at the edge of the lagoons, about 10 kilometres (6 mi) from the sea, on the river Natiso (modern Natisone), the course of which has changed somewhat since the Roman era. In classical antiquity, Aquileia was a major Roman city with an estimated population close to 100,000 in the 2nd century AD. Founded as a Roman military colony in 181 BC, Aquileia became the capital of the Augustan X region and a metropolitan center for early Christianity. During late antiquity, it was the first city in the Italian Peninsula to be sacked by Attila the Hun. Today, Aquileia is one of the most significant archaeological sites in northern Italy. Its ruins, including mosaics and an early Christian basilica, are a UNESCO World Heritage Site. Aquileia also holds historical importance as one of the former capitals of Friuli, with its coat of arms being the symbol of the region.
In 2020, some major companies and institutions started to acquire bitcoin: MicroStrategy invested $250 million in bitcoin as a treasury reserve asset, Square, Inc., $50 million, and MassMutual, $100 million. In November 2020, PayPal added support for bitcoin in the US. In February 2021, bitcoin's market capitalization reached $1 trillion for the first time. In November 2021, the Taproot soft-fork upgrade was activated, adding support for Schnorr signatures, improved functionality of smart contracts and Lightning Network. Before, bitcoin only used a custom elliptic curve with the ECDSA algorithm to produce signatures. In September 2021, bitcoin became legal tender currency in El Salvador, alongside the US dollar. In October 2021, the first bitcoin futures exchange-traded fund (ETF), called BITO, from ProShares was approved by the SEC and listed on the CME. In early 2022, during the Canadian trucker protests opposing COVID-19 vaccine mandates, organizers turned to bitcoin to receive donations after traditional financial platforms restricted access to funding. Proponents highlighted bitcoin's use as a tool for fundraising in situations where access to conventional financial systems may be restricted. In May and June 2022, the bitcoin price fell following the collapses of TerraUSD, a stablecoin, and the Celsius Network, a cryptocurrency loan company. In 2023, ordinals—non-fungible tokens (NFTs)—on bitcoin, went live. As of June 2023, River Financial estimated that bitcoin had 81.7 million users, about 1% of the global population.
Squadron Leader Iain Roderic Gillespie (2618287), (Retired). Warrant Officer Anthony John Gough, , (N1944467). Corporal (now Acting Sergeant) Alistair Colin Green (B8213475). Warrant Officer Michael John Hatch (M0593513). Squadron Leader Mark William Gardner Hopkins (2625781). Warrant Officer William James Cameron Kearney, , (D1949781). Sergeant Gary Kennedy (L8001367). Sergeant Roy Martin (A8015128). Warrant Officer Brian David Medland (R1949361), (Retired). Corporal (now Acting Sergeant) Kevin John Mulloy (F8201300). Corporal Ian William Partington (T8153337). Squadron Leader Vivienne Alexandra Sim (2797569), (Retired). Warrant Officer Keith Alexander Smith (P8089172). Squadron Leader Steven Glynn Smyth (8025529). Warrant Officer Barry Walch (U4287360). Junior Technician Peter Allan Wildman (D8410829). Squadron Leader Timothy Andrew Wilkinson (5203138). Master Aircrew Alistair John Woolfson (T8018944). Civil Division Kenneth Elliott Ackerley. For services to Physically Handicapped People. Graham Clifford Adams, Storekeeper, Manufacturing Division, Rolls-Royce & Associates plc. For services to the Automobile Industry. William Aitken. For services to the community in Aberdeen. Anne Aldred, Revenue Assistant, Board of Inland Revenue. Richard John Alibone, Senior Professional Technical Officer, Foreign and Commonwealth Office. Lieutenant Commander Peter Douglas Allen, Royal Navy (Retd.), Retired Officer 2, Ministry of Defence. Yashwanti Chandrakant Amlani. For services to Community Relations in Bristol. Ann McCall Amos, Personal Secretary, Ministry of Defence.
== Novel == The Picture of Dorian Gray (1890/1891) was Wilde's only complete novel. The first version of "The Picture of Dorian Gray" was published, in a form highly edited by the magazine, as the lead story in the July 1890 edition of Lippincott's Monthly Magazine. Wilde published the longer and revised version in book form in 1891, with an added preface. The Uncensored Picture of Dorian Gray was published by the Belknap Press of Harvard University Press in 2012.
The Indian Army has its origins in the years after the Indian Rebellion of 1857, often called the Indian Mutiny in British histories, when in 1858 the Crown took over direct rule of British India from the East India Company. Before 1858, the precursor units of the Indian Army were units controlled by the Company and were paid for by their profits. These operated alongside units of the British Army, funded by the British government in London. The three Presidency armies remained separate forces, each with its own Commander-in-Chief. Overall operational control was exercised by the Commander-in-Chief of the Bengal Army, who was formally the Commander-in-Chief of the East Indies. From 1861, most of the officer manpower was pooled in the three Presidential Staff Corps. After the Second Afghan War a Commission of Enquiry recommended the abolition of the presidency armies. The Ordnance, Supply and Transport, and Pay branches were by then unified. The Punjab Frontier Force was under the direct control of the Lieutenant-Governor of the Punjab during peacetime until 1886, when it came under the Commander-in-Chief, India. The Hyderabad Contingent and other local corps remained under direct governmental control. Standing higher formations—divisions and brigades—were abandoned in 1889. No divisional staffs were maintained in peacetime, and troops were dispersed throughout the sub-continent, with internal security as their main function. In 1891 the three staff corps were merged into one Indian Staff Corps.
Sources: en.wikipedia.org
It is a 28-residue synthetic peptide studied as an immune-modulating agent and approved as a drug in some countries. The sequence matches a naturally occurring fragment isolated from thymus tissue. It is not a hormone in the endocrine sense.
The name traces back to thymosin fraction 5, a crude thymus extract examined in the 1970s. Individual peptides in that mixture were labeled with Greek letters, and alpha-1 was one of them. The international nonproprietary name thymalfasin was assigned later.
No. Thymosin beta-4 contains 43 residues and binds actin, while thymosin alpha-1 contains 28 residues and acts on immune cells. The two sit in a historical naming group but share no sequence similarity, and they are not substitutes for one another.
The name reflects an early convention for naming thymus-derived fractions. The peptide is characterized and measured as a defined molecule, and it does not operate through a single classical endocrine axis.