Peptide stability comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Thymosin beta-4 is a separate 43-residue peptide that binds actin and participates in cell migration; it shares no sequence similarity with thymosin alpha-1 despite the common family name. Other preparative materials, such as thymosin fraction 5 and thymopoietin, contain distinct mixtures or peptides. The shared thymosin label reflects the tissue of origin used in early purification, not a common structural core. Treating these molecules as interchangeable is a frequent source of confusion in laboratory reports and in popular summaries alike.
Thymosin alpha-1 is a synthetic peptide of 28 amino acid residues that corresponds to a naturally occurring fragment first isolated from thymus tissue. Its chain is acetylated at the amino terminus, a modification that shields the peptide from rapid cleavage by aminopeptidases. The molecule carries a net negative charge at physiological pH and dissolves freely in water. Researchers classify it as an immune-modulating agent rather than a classical hormone, because it acts on several cell types of both the innate and the adaptive immune system.
The peptide was identified during work in the 1970s on thymosin fraction 5, a partially purified extract of calf thymus. Investigators separated that mixture and characterized individual components, one of which they named thymosin alpha-1. The same compound later received the international nonproprietary name thymalfasin. Commercial material is produced by solid-phase peptide synthesis rather than by extraction, so synthetic and natural forms share an identical sequence. Naming conventions vary across the literature, and readers should distinguish the alpha-1 peptide from other thymosins that have unrelated sequences and functions.
Identity and purity are normally confirmed by reversed-phase high-performance liquid chromatography and mass spectrometry. The expected mass for the acetylated 28-residue peptide is close to 3108 daltons, and a mass shift indicates a modification or truncation. Peptide mapping after enzymatic digestion can resolve sequence-level questions. Counter-ion content, water content, and residual solvents are separate quality attributes that a certificate of analysis may or may not report. Aggregation is monitored by size-exclusion chromatography when relevant.
Thymosin alpha-1 is supplied as a lyophilized powder in most research settings. The solid dissolves readily in water and in common aqueous buffers, and it is typically reconstituted shortly before use. Solutions are clear and colourless at ordinary working concentrations. Because the peptide is hygroscopic, weighing and reconstitution are usually performed with minimal exposure to ambient air. Aliquots are prepared to avoid repeated freeze-thaw cycles, and working solutions are kept cold.
Long-term storage is generally at minus twenty degrees Celsius or colder, preferably desiccated and protected from light. Lyophilized material is more stable than reconstituted solution, which degrades faster at room temperature. Stability depends on pH, ionic strength, and the presence of oxidising agents. Published stability data for the peptide are limited, so storage claims in catalogues should be treated as general guidance rather than measured guarantees. Freeze-thaw cycles are kept to a minimum.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | About 3.1 kDa | 28 residues, N-terminally acetylated |
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Freely soluble in water | Also soluble in aqueous buffers |
| Storage temperature | 2 to 8 °C | Protect from light and moisture |
| Common synonyms | Thymalfasin; Tα1 | Same peptide sequence |
Within the immune system, the peptide acts on several cell types rather than a single target. Reported activities include promotion of T-cell maturation, enhancement of natural killer cell activity, and modulation of cytokine production by dendritic cells and macrophages. Some of these effects appear to operate through toll-like receptor signaling, though the precise receptor-level mechanism remains debated. Whether the observed immune changes translate into clinical benefit is a separate question and depends on the indication studied.
The peptide was described in the 1970s as a component of thymic extracts, and early research focused on restoring immune function in immunodeficiency states. A synthetic version entered clinical development in the 1980s and is approved as a drug in several countries for conditions such as chronic hepatitis B and certain immunodeficiencies. Approval status varies widely by jurisdiction, and in the United States it is not an approved therapeutic. Regulatory and clinical positions differ, so statements about efficacy should be tied to specific indications and studies.
Thymosin alpha-1 is a synthetic peptide of 28 amino acids, corresponding to the N-terminal fragment of prothymosin alpha. Its sequence begins with acetylation at the N-terminus, a modification that affects stability and receptor interaction. The peptide is acidic, with a calculated isoelectric point near 4.2, and carries no disulfide bonds, so its secondary structure is largely flexible in solution. Molecular mass is approximately 3108 daltons. The native form was first isolated from bovine thymus tissue, while pharmaceutical material is produced by solid-phase peptide synthesis.
The peptide occurs naturally in thymic tissue and has been detected in serum and other biological fluids. Reported concentrations are low, and reliable measurement generally requires immunoassay or mass spectrometry with an enrichment step. It is released from a larger precursor, prothymosin alpha, by proteolytic cleavage, although the enzymes involved are not fully characterized. Whether circulating levels reflect thymic output specifically remains an open question.
Thymosin alpha 1 is a 28-amino-acid peptide first isolated from thymosin fraction 5, a bovine thymic extract. Its sequence begins with an acetylated serine residue and carries a high proportion of acidic residues, so the molecule has a net negative charge near neutral pH. Despite the shared name, it is unrelated in sequence to the thymosin beta family. Synthetic material prepared by solid-phase peptide synthesis is identical in sequence to the natural peptide.
Whether the free 28-residue peptide circulates in human tissue remains debated. The best-documented human source is prothymosin alpha, a larger acidic protein that carries the sequence at its N-terminus. Reports of measurable peptide levels in serum and lymphoid tissue exist, yet some of that signal may come from cross-reacting fragments or from the parent protein. Most reviews therefore treat prothymosin alpha as the established human molecule and describe independent circulation of the small peptide as an unresolved question.
Immunological studies connect the peptide to multiple parts of the immune response. It has been reported to engage Toll-like receptor signaling, to promote dendritic cell maturation, and to influence the balance of T helper cell subsets. Changes in natural killer cell activity and in cytokine release appear in cell culture and animal models. These observations describe broad immunomodulatory behavior rather than a single defined receptor target, and the primary molecular interaction has not been settled.
Reverse-phase high-performance liquid chromatography is the standard technique for assessing purity and concentration, because the peptide's hydrophobicity allows clean separation from related impurities. Mass spectrometry confirms molecular identity and detects sequence errors or truncations. Amino acid analysis and peptide mapping supply additional structural confirmation when required. Chromatographic purity values reported on certificates of analysis describe the proportion of the main peak and do not by themselves establish biological activity.
Like most short peptides, thymosin alpha-1 is susceptible to hydrolysis under strongly acidic or basic conditions and to oxidation when exposed to air over long periods. The acetylated amino terminus blocks one common degradation route, which contributes to the molecule's relative robustness in solution. Lyophilized material generally retains potency for extended periods when kept cold and dry. Once reconstituted, aqueous solutions are less stable and are typically used within a defined window rather than held indefinitely at ambient temperature.
==== Pneumofathometer ==== A pneumofathometer is a device used to measure the depth of a diver by displaying the back-pressure on a gas supply hose with an open end at the diver, and a flow rate with negligible resistance in the hose. The pressure indicated is the hydrostic pressure at the depth of the open end, and is usually displayed in units of metres or feet of seawater, the same units used for decompression calculations. The pneumo line is usually a 0.25 inches (6.4 mm) bore hose in the diver's umbilical, supplied with breathing gas from the gas panel via a supply valve. Downstream from the valve there is a branch to a high resolution pressure gauge, a restriction to flow to the gauge, and an overpressure relief valve to protect the gauge from full panel supply pressure in case the pneumo line is used for emergency breathing gas supply. Each diver has an independent pneumofathometer, and if there is a bell, it will also have an independent pneumofathometer.
=== Mayor of Nuevo Cuscatlán === In 2011, Bukele announced that he would enter politics as a member of the FMLN to break out of "his comfort zone" ("su zona de confort") as a businessman. Officially joining the party in 2012, he campaigned for the mayoralty of Nuevo Cuscatlán, a municipality in the department of La Libertad, part of the San Salvador metropolitan area. Bukele's campaign was supported by the Democratic Change party. He was elected mayor of Nuevo Cuscatlán in March 2012 with 51.67 percent of the vote, defeating primary challenger Tomás Rodríguez of the Nationalist Republican Alliance (ARENA). Bukele took office on 1 May 2012 as the country's youngest mayor. Bukele created a scholarship program for youths in the municipality, donating his $2,000 salary to fund the program. In August 2014, Bukele launched Sphere PM, a project that launched a high-altitude balloon to an altitude of 100,000 feet (30,000 m) and took pictures of El Salvador. He stated that Sphere PM's goal was to promote education in science and technology to dissuade the municipality's youth from crime. Bukele spoke at the United Nations headquarters about projects he had undertaken as mayor of Nuevo Cuscatlán as part of the November 2014 World Cities Day. In January 2015, he inaugurated a $1.7 million boulevard connecting Nuevo Cuscatlán with Huizúcar and Antiguo Cuscatlán. Bukele did much of his mayoral work with funding from ALBA Petróleos, owned by the Venezuelan oil company PDVSA.
The end result will thus be multiple organ failure [10] and damage to the muscles and nerves in the arms and legs. The animal trials done before the clinical trial had failed to predict this extreme species-selective toxicity. This is mainly due to that humans have the human equilibrate nucleoside transporter-1 (hENT-1) which will allow selective uptake of FIAU into the mitochondria in a way that other species do not.
==== Mongolia ==== After serious opposition about plans and negotiations between Mongolia with Japan and the United States to build nuclear-waste facilities in Mongolia, Mongolia stopped all negotiations in September 2011. These negotiations had started after U.S. Deputy Secretary of Energy Daniel Poneman visited Mongolia in September 2010. Talks took place in Washington, D.C. between officials of Japan, the United States, and Mongolia in February 2011. After this the United Arab Emirates (UAE), which wanted to buy nuclear fuel from Mongolia, joined in the negotiations. The talks were kept secret and, although the Mainichi Daily News reported on them in May, Mongolia officially denied the existence of these negotiations. Alarmed by this news, Mongolian citizens protested against the plans and demanded the government withdraw the plans and disclose information. The Mongolian President Tsakhiagiin Elbegdorj issued a presidential order on September 13 banning all negotiations with foreign governments or international organizations on nuclear-waste storage plans in Mongolia. The Mongolian government has accused the newspaper of distributing false claims around the world. After the presidential order, the Mongolian president fired the individual who was supposedly involved in these conversations.
Here P1 and V1 represent the original pressure and volume, respectively, and P2 and V2 represent the second pressure and volume. Boyle's law, Charles's law, and Gay-Lussac's law form the combined gas law. The three gas laws in combination with Avogadro's law can be generalized by the ideal gas law.
Sources: en.wikipedia.org
In February 2011, the European Commission's Committee for Medicinal Products for Human Use approved the product for the treatment of Dupuytren's contracture in adults with a palpable cord by 'properly trained' doctors. Pfizer was reported to be working with Europe's national medicines regulatory bodies to launch the new treatment, hoping doctors could prescribe the treatment by late 2011. On November 7, 2012, BioSpecifics announced "BioSpecifics Technologies Corp. : Reports Third Quarter 2012 Financial Results". Auxilium's submission of a License Application to the FDA for Xiaflex for the potential treatment of Peyronie's disease, an excess of inelastic collagen causing penile curvature deformity. The FDA approved Xiaflex for the treatment of Peyronie’s disease in December 2013. Following this, Xiapex gained EU approval for the treatment of Peyronie’s disease in February 2015, making it the first and only biologic therapy indicated for the treatment of Peyronie's disease. Auxilium has also reported additional trials for potential use of Xiaflex are underway for the treatment of frozen shoulder, cellulite reductions and both human and canine lipomas. In March 2020, the Swedish manufacturer abruptly withdrew distribution of this drug in Europe for commercial reasons. Collagenase is no longer available on the National Health System except as part of a small clinical trial.
==== Fatal outcomes in case reports ==== A 2017 case report details the severe, prolonged episode of drug-induced parkinsonism in a 68‑year‑old man in the United States that ultimately led to his death roughly five months after receiving two injections of paliperidone palmitate (234 mg followed one week later by 156 mg). The authors state that "practitioners should be cognizant of the potential long‑term consequences of paliperidone LAI." A 47‑year‑old man (Japan, 2017) developed acute and persistent circulatory failure after receiving paliperidone palmitate injections. Despite surgical removal of the hip tissue suspected of containing the paliperidone palmitate depot, he died of multiple organ failure. When examining the removed tissue, it seemed that paliperidone palmitate was not present, and Janssen, the drug manufacturer, does not recommend this approach since it is practically impossible to locate the depot of paliperidone. The optimal treatment of long‐acting injectable (LAI) antipsychotic poisonings is unknown. In 2019, it was reported that a 33-year-old man in France was found dead in his room at his parents' home after receiving a single 819 mg injection of Trevicta (paliperidone palmitate three‑monthly formulation). Toxicological analysis of femoral blood revealed paliperidone at 240 μg/L; no other substance was detected. The authors concluded that paliperidone poisoning was the highly likely cause of death.
== Neuroscience organizations == The largest professional neuroscience organization is the Society for Neuroscience (SFN), which is based in the United States but includes many members from other countries. Since its founding in 1969 the SFN has grown steadily: as of 2010 it recorded 40,290 members from 83 countries. Annual meetings, held each year in a different American city, draw attendance from researchers, postdoctoral fellows, graduate students, and undergraduates, as well as educational institutions, funding agencies, publishers, and hundreds of businesses that supply products used in research. Other major organizations devoted to neuroscience include the International Brain Research Organization (IBRO), which holds its meetings in a country from a different part of the world each year, and the Federation of European Neuroscience Societies (FENS), which holds a meeting in a different European city every two years. FENS comprises a set of 32 national-level organizations, including the British Neuroscience Association, the German Neuroscience Society (Neurowissenschaftliche Gesellschaft), and the French Société des Neurosciences. The first National Honor Society in Neuroscience, Nu Rho Psi, was founded in 2006. Numerous youth neuroscience societies which support undergraduates, graduates and early career researchers also exist, such as Simply Neuroscience and Project Encephalon. In 2013, the BRAIN Initiative was announced in the US.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Femarelle is a dietary supplement range containing DT56a, a tofu-derived soy extract, together with additional ingredients including flaxseed powder, vitamins, and minerals. DT56a has been studied for its potential activity as a selective estrogen receptor modulator (SERM), meaning that it may interact selectively with estrogen receptors in different tissues. Femarelle has been evaluated in several clinical studies investigating its possible role in supporting women during menopause, including studies on menopausal symptoms, vaginal health, bone health, and safety profile. Some studies reported encouraging findings, including improvements in menopausal symptoms and a favorable safety profile compared with traditional hormone replacement therapy, although the published trials were generally limited by relatively small sample sizes and short study durations. In 2008, an application was submitted to the European Food Safety Authority (EFSA) regarding a health claim related to bone mineral density and osteoporosis risk. EFSA concluded that the available evidence at that time was insufficient to establish a cause-and-effect relationship between Femarelle consumption and improvements in bone mineral density or reduction of osteoporosis risk in postmenopausal women.
It is understood that rearrangement occurs between specific sites on the DNA called recombination signal sequences (RSSs). The signal sequences are composed of a conserved palindromic heptamer and a conserved AT- rich nonamer. These signal sequences are separated by non-conserved spacers of 12 or 23 base pairs called one-turn and two-turn respectively. They are within the lambda chain, k-chain and the processes of rearrangement in these regions are catalyzed by two recombination-activating genes: RAG-1 and RAG-2 and other enzymes and proteins. The segments joined due to signals generated RSSs that flank each V, D, and J segments. Only genes flank by 12 -bp that join to the genes flank by 23-bp spacer during the rearrangements and combinations to maintain VL-JL and VH-DH-JH joining.
=== Radioactivity === Thorium was first observed to be radioactive in 1898, by the German chemist Gerhard Carl Schmidt and later that year, independently, by the Polish-French physicist Marie Curie. It was the second element that was found to be radioactive, after the 1896 discovery of radioactivity in uranium by French physicist Henri Becquerel. Starting from 1899, the New Zealand physicist Ernest Rutherford and the American electrical engineer Robert Bowie Owens studied the radiation from thorium; initial observations showed that it varied significantly. It was determined that these variations came from a short-lived gaseous daughter of thorium, which they found to be a new element. This element is now named radon, the only one of the rare radioelements to be discovered in nature as a daughter of thorium rather than uranium. After accounting for the contribution of radon, Rutherford, now working with the British physicist Frederick Soddy, showed how thorium decayed at a fixed rate over time into a series of other elements in work dating from 1900 to 1903. This observation led to the identification of the half-life as one of the outcomes of the alpha particle experiments that led to the disintegration theory of radioactivity. The biological effect of radiation was discovered in 1903. The newly discovered phenomenon of radioactivity excited scientists and the general public alike. In the 1920s, thorium's radioactivity was promoted as a cure for rheumatism, diabetes, and sexual impotence.
Selenoinsulin (abbreviated to Se-Ins) is an experimental insulin analogue first described in 2017. It is a modified form of bovine pancreatic insulin in which the interchain disulfide bond between residues A7 and B7 is replaced with a diselenide bond formed by two selenocysteine residues. In laboratory studies, selenoinsulin retained biological activity comparable to that of bovine pancreatic insulin and showed greater resistance to degradation by the insulin-degrading enzyme (IDE).
Pan genomics is a concept introduced in 2005 by Tettelin and Medini. Pan genome is the complete gene repertoire of a particular monophyletic taxonomic group. Although initially applied to closely related strains of a species, it can be applied to a larger context like genus, phylum, etc. It is divided in two parts: the Core genome, a set of genes common to all the genomes under study (often housekeeping genes vital for survival), and the Dispensable/Flexible genome: a set of genes not present in all but one or some genomes under study. A bioinformatics tool BPGA can be used to characterize the Pan Genome of bacterial species.
Sources: en.wikipedia.org
It is a 28-residue synthetic peptide studied as an immune-modulating agent and approved as a drug in some countries. The sequence matches a naturally occurring fragment isolated from thymus tissue. It is not a hormone in the endocrine sense.
The name traces back to thymosin fraction 5, a crude thymus extract examined in the 1970s. Individual peptides in that mixture were labeled with Greek letters, and alpha-1 was one of them. The international nonproprietary name thymalfasin was assigned later.
No. Thymosin beta-4 contains 43 residues and binds actin, while thymosin alpha-1 contains 28 residues and acts on immune cells. The two sit in a historical naming group but share no sequence similarity, and they are not substitutes for one another.
Lyophilized powder is normally kept at minus twenty degrees Celsius or below, in a sealed container, desiccated and away from light. Reconstituted solutions are less stable and are usually refrigerated and used quickly. Repeated temperature cycling should be avoided.