vaccine adjuvant raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-02-02. Anything still debated is marked as such rather than presented as settled.
Thymosin alpha 1 was identified in 1977 as a component of thymosin fraction 5, a heterogeneous preparation used in early studies of thymic function. Investigators purified the active material and determined its amino acid sequence, which enabled chemical synthesis. Work in the following decades concentrated on T-cell maturation and immune reconstitution in animals and small human cohorts. Early preparations varied in composition, so results from that period are difficult to compare with studies using defined synthetic peptide.
Clinical research has examined the peptide in chronic hepatitis B and C, as a vaccine adjuvant, and in sepsis and oncology settings. Findings across trials are mixed; some report changes in selected immune markers, while others find no clear clinical benefit. Many studies are small and define outcomes differently, which limits comparison. Regulatory approval is confined to a few countries, and the compound is not an approved drug in the United States or most of Europe.
Thymosin alpha 1 is a short peptide of 28 amino acid residues that derives from the amino terminal region of a larger precursor protein known as prothymosin alpha. The peptide carries an acetyl group on its first residue and contains no disulfide bonds or carbohydrate chains. Its sequence is highly conserved across mammalian species, which is one reason laboratories treat it as a molecule with a defined and reproducible structure rather than a variable tissue extract. The name follows an early naming convention for thymus-derived fractions and does not imply that the peptide acts as a hormone in the classical endocrine sense.
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
| Property | Value | Notes |
|---|---|---|
| First described | 1977 | Reported as a component of thymosin fraction 5 |
| Sequence length | 28 amino acids | N-terminal residue is acetylated |
| Net charge at neutral pH | Negative | Reflects a high proportion of acidic residues |
| Principal studied uses | Chronic hepatitis B and vaccine adjuvant | Research uses outnumber approved indications |
| Regulatory status | Approved in a limited number of countries | Not approved in the United States or most of Europe |
Thymosin alpha-1 is a synthetic peptide of 28 amino acids, corresponding to the N-terminal fragment of prothymosin alpha. Its sequence begins with acetylation at the N-terminus, a modification that affects stability and receptor interaction. The peptide is acidic, with a calculated isoelectric point near 4.2, and carries no disulfide bonds, so its secondary structure is largely flexible in solution. Molecular mass is approximately 3108 daltons. The native form was first isolated from bovine thymus tissue, while pharmaceutical material is produced by solid-phase peptide synthesis.
Within the immune system, the peptide acts on several cell types rather than a single target. Reported activities include promotion of T-cell maturation, enhancement of natural killer cell activity, and modulation of cytokine production by dendritic cells and macrophages. Some of these effects appear to operate through toll-like receptor signaling, though the precise receptor-level mechanism remains debated. Whether the observed immune changes translate into clinical benefit is a separate question and depends on the indication studied.
The molecule consists of 28 amino acid residues with an acetyl group attached to the N-terminal serine. Its sequence is acidic overall, with several glutamic and aspartic acid residues distributed along the chain and no cysteine, so disulfide bridges do not form. The peptide carries a net negative charge at physiological pH. Because the N-terminus is blocked, the intact molecule resists degradation by many aminopeptidases, which contributes to its stability in biological fluids.
The peptide is generated in cells by cleavage of prothymosin alpha, a larger acidic protein encoded by the PTMA gene. Prothymosin alpha is expressed in many tissues, not only in the thymus, and its functions include nuclear roles in chromatin-related processes. The 28-residue fragment corresponds to the N-terminal portion of that precursor. How the cleavage occurs and how the fragment's concentration is regulated remain open questions; circulating amounts are small and difficult to measure reliably with routine assays.
== Blood levels == In healthy females AMH is either just detectable or undetectable in cord blood at birth and demonstrates a marked rise by three months of age; while still detectable it falls until four years of age before rising linearly until eight years of age remaining fairly constant from mid-childhood to early adulthood – it does not change significantly during puberty. The rise during childhood and adolescence is likely reflective of different stages of follicle development. From 25 years of age AMH declines to undetectable levels at menopause. The standard measurement of AMH follows the Generation II assay. This should give the same values as the previously used IBC assay, but AMH values from the previously used DSL assay should be multiplied with 1.39 to conform to current standards because it used different antibodies. Weak evidence suggests that AMH should be measured only in the early follicular phase because of variation over the menstrual cycle. Also, AMH levels decrease under current use of oral contraceptives and current tobacco smoking.
Biological therapy, the use of medications called biopharmaceuticals or biologics that are tailored to specifically target an immune or genetic mediator of disease, plays a major role in the treatment of inflammatory bowel disease. Even for diseases of unknown cause, molecules that are involved in the disease process have been identified, and can be targeted for biological therapy. Many of these molecules, which are mainly cytokines, are directly involved in the immune system. Biological therapy has found a niche in the management of cancer, autoimmune diseases, and diseases of unknown cause that result in symptoms due to immune related mechanisms. Inflammatory bowel disease (IBD), a collection of systemic diseases involving inflammation of the gastrointestinal tract, includes two (or three) diseases of unknown causation: ulcerative colitis, which affects only the large bowel; Crohn's disease, which can affect the entire gastrointestinal tract; and indeterminate colitis, which consists of large bowel inflammation that shows elements of both Crohn's disease and ulcerative colitis. Although the causes of these diseases are unknown, genetic, environmental, immune, and other mechanisms have been proposed. Of these, the immune system plays a large role in the development of symptoms. Given this, a variety of biological therapies (such as TNF inhibitors and interleukin antagonists) have been developed for the treatment of these diseases.
=== All-terrain droplet actuation (ATDA) === All-terrain microfluidics is a method used to transport liquid droplets over non-traditional surface types. Unlike traditional microfluidics platform, which are generally restricted to planar and horizontal surfaces, ATDA enables droplet manipulation over curved, non-horizontal, and inverted surfaces. This is made possible by incorporating flexible thin sheets of copper and polyimide into the surface via a rapid prototyping method. This device works very well with many liquids, including aqueous buffers, solutions of proteins and DNA, and undiluted bovine serum. ATDA is compatible with silicone oil or pluronic additives, such as F-68, which reduce non-specific absorption and biofouling when dealing with biological fluids such as proteins, biological serums, and DNA. A drawback of a setup like this is accelerated droplet evaporation. ATDA is a form of open digital microfluidics, and as such the device needs to be encapsulated in a humidified environment in order to minimize droplet evaporation.
Sources: en.wikipedia.org
=== Classes of AID systems === Currently available AID systems fall into three broad classes based on their capabilities. The first systems released can only halt insulin delivery (predictive low glucose suspend) in response to already low or predicted low glucose. Hybrid Closed Loop systems can modulate delivery both up and down, although users still initiate insulin doses (boluses) for meals and typically "announce" or enter meal information. Fully Closed Loops require no manual insulin delivery actions or announcement for meals.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
=== Nanoparticle Albumin-bound (nab) Technology === Nanoparticle albumin-bound technology utilizes the protein albumin as a carrier for hydrophobic chemotherapy drugs through noncovalent binding. Because albumin is already a natural carrier of hydrophobic particles and is able to transcytose molecules bound to itself, albumin composed nanoparticles have become an effective strategy for the treatment of many diseases in clinical research.
Sources: en.wikipedia.org
== Medications == As of 2015, there were eight FDA-approved SNRIs in the United States, with venlafaxine being the first drug to be developed in 1993 and levomilnacipran being the latest drug to be developed in 2013. The drugs vary by their other medical uses, chemical structure, adverse effects, and efficacy.
=== Scalp hair loss === Clascoterone is under development for the treatment of androgen-dependent scalp hair loss. Two phase 3 clinical trials were completed and disclosed in December 2025. The drug significantly improved hair growth in both trials. More specifically, target area hair count (TAHC) had a relative improvement of 5.39-fold (539%) in one study and of 1.68-fold (168%) in the other study, both compared to placebo. In other words, hair growth improved in both the placebo and clascoterone groups, but growth improved by about 1.7- to 5.4-fold more with clascoterone than with placebo. The actual absolute changes in hair counts in the different groups have not yet been released.
Jake Austin Walker as Henry King Jr. (season 1; guest season 2):A student at Blue Valley High as well as its star football player. He later develops psionic powers after experiencing emotional distress following his father becoming comatose. His deceased mother was Sylvester Pemberton's sister Merry. Meg DeLacy as Cindy Burman / Shiv:The daughter of the Dragon King, girlfriend of Henry King Jr. and the most popular student at Blue Valley High with enhanced abilities and wields wrist blades from her skin. While she is the school's cheerleading captain, she is determined to follow in her father's footsteps. In pursuit of this, she acquired a powerful suit of armor and a flame-throwing staff. In the second season, she teams up with Eclipso and forms a new ISA called Injustice Unlimited. In the third and final season, she wants to change her ways and joins the new JSA. Later, Cindy starts to manifest a reptilian form due to her father's experiments on her throughout her childhood. Neil Jackson as Jordan Mahkent / Icicle (season 1; recurring season 3; guest season 2):The leader of the Injustice Society of America (ISA), an "astute" businessman with the power of cryokinesis and founder of a firm called The American Dream that is responsible for the revitalization of Blue Valley. Jackson initially thought "Icicle" was "a silly name" and made the character sound "like a My Little Pony", but Johns' pitch helped make the character credible for Jackson. In the third and final season, Icicle had spent the following year reconstituting himself after he was shattered by Mike Dugan.
The Combined DNA Index System (CODIS) is a database that the FBI uses to hold genetic profiles of all known felons, misdemeanants, and arrestees. Some people argue that individuals who are using genealogy databases should have an expectation of privacy in their data that is or may be violated by genetic searches by law enforcement. These different services have warning signs about potential third parties using their information, but most individuals do not read the agreement thoroughly. According to a study by Christi Guerrini, Jill Robinson, Devan Petersen, and Amy McGuire, they found that the majority of the people who took the survey support police searches of genetic websites that identify genetic relatives. People who responded to the survey are more supportive of police activities using genetic genealogy when it is for the purpose of identifying offenders of violent crimes, suspects of crimes against children or missing people. The data from the surveys that were given show that individuals are not concerned about police searches using personal genetic data if it is justified. It was found in this study that offenders are disproportionally low-income and black and the average person of genetic testing is wealthy and white. The results from the study had different results. In 2016, there was a survey called the National Crime Victimization Survey (NCVS) that was provided by the US Bureau of Justice Statistics. In that survey, it was found that 1.3% of people aged 12 or older were victims of violent crimes, and 8.85 of households were victims of property crimes.
Sources: en.wikipedia.org
Trials differ in patient population, dose schedule, background treatment, and the endpoints used to judge success. Many are small and single-center, so random variation can dominate the reported effects.
Authorization is limited to a small number of countries and covers specific indications such as chronic hepatitis B and vaccine adjuvant use. Availability and labelling differ by jurisdiction.
Most reviews describe it as an immunomodulatory agent with an uncertain clinical effect. They generally call for larger, better-controlled trials before firm conclusions are drawn.
The name reflects an early convention for naming thymus-derived fractions. The peptide is characterized and measured as a defined molecule, and it does not operate through a single classical endocrine axis.